PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Achn367381
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; Ericales; Actinidiaceae; Actinidia
Family G2-like
Protein Properties Length: 459aa    MW: 51480.2 Da    PI: 8.4757
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Achn367381genomeIKGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like99.62.1e-31361414255
     G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                 prlrWtp+LH +Fv+ave+LGG+e+AtPk +l+lm+vkgL+++hvkSHLQ+YR 
  Achn367381 361 PRLRWTPDLHLAFVRAVERLGGQERATPKLVLQLMNVKGLSIAHVKSHLQMYRN 414
                 8****************************************************6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089114.4245106IPR004883Lateral organ boundaries, LOB
PfamPF031951.1E-19660IPR004883Lateral organ boundaries, LOB
PfamPF078477.9E-6397277IPR012864Cysteine oxygenase/2-aminoethanethiol dioxygenase
SuperFamilySSF511824.84E-2799255IPR011051RmlC-like cupin domain
Gene3DG3DSA:2.60.120.101.1E-13137242IPR014710RmlC-like jelly roll fold
PROSITE profilePS5129412.857357417IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.7E-29357415IPR009057Homeodomain-like
SuperFamilySSF466892.33E-14359415IPR009057Homeodomain-like
TIGRFAMsTIGR015571.7E-22361416IPR006447Myb domain, plants
PfamPF002496.2E-9362413IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0055114Biological Processoxidation-reduction process
GO:0003677Molecular FunctionDNA binding
GO:0016702Molecular Functionoxidoreductase activity, acting on single donors with incorporation of molecular oxygen, incorporation of two atoms of oxygen
Sequence ? help Back to Top
Protein Sequence    Length: 459 aa     Download sequence    Send to blast
MSNSTRCAAC KSLRRRCSQD CVLAPYFPAN NPHRFACVHR IYGASNVTKI LEVASEKVRR  60
KGSIDCGADF SSPIWFTVRN PVAIRCNFDF VQGTFDDKIK PSDVGLEQEA QLVRGWTGSV  120
NGRNGDLQPP PSITYLNLHE CESFYMGIFC LPPSSIIPLH NHPEMTVLNK LLYGTLNVKS  180
FDWVDVSGPS KQLQARPAKL VKNAEMRAPC ETTVLYPTSG GNIHCFKAVT PCAIFDILSP  240
PYSANDGRDC TYFQRSPRVD LPANLEEHQY VHMMETTTRS TMAETIEISD EDQTLGSDHS  300
QKYSSFDLNE VAIDQEGNSR TNEDRASPEG DSSSNNTTLE GKERMSGSSS MVRQYIRSKM  360
PRLRWTPDLH LAFVRAVERL GGQERATPKL VLQLMNVKGL SIAHVKSHLQ MYRNKKLDGS  420
GQAPRTKRRS TSEHQRRGME AKSTVEFEPR LPKREQNE*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38300.11e-37G2-like family protein